PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1508s0081.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 257aa    MW: 29931.4 Da    PI: 9.2419
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1508s0081.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.35.6e-25959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krie+ ++rqvtf+kRr+ ++KKA+ELSvLCd+   +iifs +++ly+++s
  Cagra.1508s0081.1.p  9 KRIEDRIRRQVTFAKRRKSLMKKAHELSVLCDVHLGLIIFSYSNRLYDFCS 59
                         79***********************************************96 PP

2K-box44.37.6e-16931651385
                K-box  13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                          + +++ +  + + +eienL+ ++  + G +L+ L++ +L + e +Le+sl+++R++K e++ +qi++l+ k k
  Cagra.1508s0081.1.p  93 QCSNCAKTKETMMREIENLKINLQLYDGHGLNLLTYDDLLRFELHLESSLQHVRARKCEFMQQQINKLKGKAK 165
                          5566777788999********************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.338161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-30160IPR002100Transcription factor, MADS-box
CDDcd002651.26E-36280No hitNo description
SuperFamilySSF554551.03E-25385IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-23323IPR002100Transcription factor, MADS-box
PfamPF003199.9E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.54794207IPR002487Transcription factor, K-box
PfamPF014868.0E-1197165IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030308Biological Processnegative regulation of cell growth
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048530Biological Processfruit morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MRKGKVVIKR IEDRIRRQVT FAKRRKSLMK KAHELSVLCD VHLGLIIFSY SNRLYDFCSN  60
TTSMENLIMR YQKEKEAGHT HTSADHSFHP ADQCSNCAKT KETMMREIEN LKINLQLYDG  120
HGLNLLTYDD LLRFELHLES SLQHVRARKC EFMQQQINKL KGKAKCTLYI SVFNTKLQQG  180
GSSWEQLMWQ AERQMMTTCQ IQDNDDVTRR QVKKEFLLFD REEEEHHQLI IGALQLVQLP  240
QPSPQPARNQ GPLSGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-17185183Myocyte-specific enhancer factor 2B
1tqe_Q4e-17185183Myocyte-specific enhancer factor 2B
1tqe_R4e-17185183Myocyte-specific enhancer factor 2B
1tqe_S4e-17185183Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00172DAPTransfer from AT1G31140Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010478557.11e-124PREDICTED: truncated transcription factor CAULIFLOWER D
TrEMBLQ9SA074e-98Q9SA07_ARATH; F28K20.7 protein
STRINGAT1G31140.21e-97(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16860910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31140.21e-101GORDITA